- Recombinant Drosophila yakuba Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 homolog (GE22313)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1077231
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 4,354 Da
- E Coli or Yeast
- 14611
- GE22313, dyak_GLEANR_600
- Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 4 homolog (GE22313)
Sequence
MISDVQLAIFSNVLGVFLFLLVVAYHYINANTGKPSAKAK